China (Mainland)
Teriparatide manufacturer CAS NO.99294-94-7
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Product Details
Keywords
- Teriparatide Acetate supplier
- Teriparatide Acetate
- high quality Teriparatide Acetate
Quick Details
- ProName: Teriparatide manufacturer
- CasNo: 99294-94-7
- Molecular Formula: C181H291N55O51S2
- Appearance: White powder
- Application: pharmaceutical
- DeliveryTime: 3days to 1month
- PackAge: According client's requirements
- Port: shanghai
- ProductionCapacity: 100 Gram/Day
- Purity: 0.98
- Storage: keep sealed and keep from direct light
- Transportation: According client's requirements
- LimitNum: 1 Gram
- Moisture Content: NML 7%
- Impurity: NML2.0%
- peptide content: NLT80%
Superiority
Our Advantages:
1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.
2. Samples free trial: our company welcome samples to test our quality then make regular orders.
3. Good Service: the company have 24 hours online service and feedback to our clients ontime
4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.
5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.
Details
Name:Teriparatide Acetate, Teriparatida , Teriparatidum
Cas No: 52232-67-4(net),99294-94-7(acetate)
Formula: C181H291N55O51S2
Molecular: 4117.71
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity:98%
Appearance: white powder
Source: synthetic
Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide
Parathar,Teriparatide Acetate,Teriparatide Aventis Brand
