China (Mainland)
GLP-1(7-37) manufacturer CAS NO.106612-94-6
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Product Details
Keywords
- GLP-1(7-37) supplier
- GLP-1(7-37)
- high quality GLP-1(7-37)
Quick Details
- ProName: GLP-1(7-37) manufacturer
- CasNo: 106612-94-6
- Molecular Formula: C151H228N40O47
- Appearance: White powder
- Application: pharmaceutical
- DeliveryTime: 3days to 1month
- PackAge: According client's requirements
- Port: shanghai
- ProductionCapacity: 100 Gram/Day
- Purity: 0.98
- Storage: keep sealed and keep from direct light
- Transportation: According client's requirements
- LimitNum: 1 Gram
- Moisture Content: NML 7%
- Impurity: NML2.0%
- peptide content: NLT80%
Superiority
Our Advantages:
1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.
2. Samples free trial: our company welcome samples to test our quality then make regular orders.
3. Good Service: the company have 24 hours online service and feedback to our clients ontime
4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.
5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.
Details
Name:GLP-1(7-37)
Cas No: 106612-94-6 (net)
Formula: C151H228N40O47
Molecular: 3355.66
Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch),
