China (Mainland)
Exendin-4 manufacturer CAS NO.141758-74-9
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,Other
- Product Details
Keywords
- Exendin-4 supplier
- Exendin-4
- high quality Exendin-4
Quick Details
- ProName: Exendin-4 manufacturer
- CasNo: 141758-74-9
- Molecular Formula: C186H286N50O62S
- Appearance: White powder
- Application: pharmaceutical ingredients ,research c...
- DeliveryTime: 3days to 1month
- PackAge: According client's requirements
- Port: hangzhou
- ProductionCapacity: 1000 Gram/Day
- Purity: 98% Min
- Storage: keep sealed and keep from direct light
- Transportation: According client's requirements
- LimitNum: 1 Gram
- Moisture Content: NML8.0%
- Impurity: NML2.0%
Superiority
Our Advantages:
1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%.
2. Samples free trial: our company welcome samples to test our quality then make regular orders.
3. Good Service: the company have 24 hours online service and feedback to our clients ontime
4. Quality guarantee: We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.
5. Fast Delivery and safe shipping: The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.
Details
Name:Exenatide Acetate, Exenatida
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
