Product Certification&
    Enterprise Certification

  • Ms.Robyn
    overseas manager
    Tel: 18248627047

  • Mobile:1824627047
  • Tel:18248627047
  • Fax:0571-87213919
  • Province/state:Zhejiang
  • City:Hangzhou
  • Street:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN
  • MaxCard:
Home > Products >  Exendin-4 manufacturer

Exendin-4 manufacturer CAS NO.141758-74-9

  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Product Details

Keywords

  • Exendin-4 supplier
  • Exendin-4
  • high quality Exendin-4

Quick Details

  • ProName: Exendin-4 manufacturer
  • CasNo: 141758-74-9
  • Molecular Formula: C186H286N50O62S
  • Appearance: White powder
  • Application: pharmaceutical ingredients ,research c...
  • DeliveryTime: 3days to 1month
  • PackAge: According client's requirements
  • Port: hangzhou
  • ProductionCapacity: 1000 Gram/Day
  • Purity: 98% Min
  • Storage: keep sealed and keep from direct light
  • Transportation: According client's requirements
  • LimitNum: 1 Gram
  • Moisture Content: NML8.0%
  • Impurity: NML2.0%

Superiority

Our Advantages:

1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 

2. Samples free trial:     our company welcome samples to test our quality then make regular orders.

3. Good Service: the company have 24 hours online service and feedback to our clients ontime

4. Quality guarantee:  We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.

5. Fast Delivery and safe shipping:   The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.

Details

Name:Exenatide Acetate, Exenatida

Cas No:141732-76-5

Formula: C186H286N50O62S

Molecular:4246.62

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Purity:98%

Appearance: white powder

Source: synthetic

Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog