Product Certification&
    Enterprise Certification

  • Mr.Eric
    Tel: 0571-87213919

  • Ms.Robyn
    overseas manager
    Tel: 18248627047

  • Mobile:
  • Tel:0571-87213919
  • Fax:0571-87213919
  • Province/state:Zhejiang
  • City:Hangzhou
  • Street:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN
  • MaxCard:
Home > Products >  Exenatide acetate manufacturer

Exenatide acetate manufacturer CAS NO.141732-76-5

  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Product Details

Keywords

  • Exenatide acetate supplier
  • Exenatide acetate
  • high quality Exenatide acetate

Quick Details

  • ProName: Exenatide acetate manufacturer
  • CasNo: 141732-76-5
  • Molecular Formula: C186H286N50O62S
  • Appearance: White powder
  • Application: pharmaceutical ingredients ,research c...
  • DeliveryTime: 3days to 1month
  • PackAge: According client's requirements
  • Port: hangzhou
  • ProductionCapacity: 1000 Gram/Month
  • Purity: 98% Min
  • Storage: keep sealed and keep from direct light
  • Transportation: According client's requirements
  • LimitNum: 1 Gram

Superiority

Our Advantages:

1.Product Capacity: eptidego has produced thousands of peptides ranging in quantity from milligrams to multiple kilograms with purities up to 99.0%. 

2. Samples free trial:     our company welcome samples to test our quality then make regular orders.

3. Good Service: the company have 24 hours online service and feedback to our clients ontime

4. Quality guarantee:  We have strict quality control system before our delivery and refunds or re-deliver if any quality problems.

5. Fast Delivery and safe shipping:   The compnay process orders in time and have much experienced in internation shipping, always keep goods safe shipping and fast delivery.

Details

Name:Exenatide Acetate, Exenatida

Cas No:141732-76-5

Formula: C186H286N50O62S

Molecular:4246.62

Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Purity:98%

Appearance: white powder

Source: synthetic

Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog